- Home
- The Tonight Show Starring Jimmy Fallon
- The Tonight Show Starring Jimmy Fallon Season 3 Episode 36
The Tonight Show Starring Jimmy Fallon Season 3 Episode 36
N/A
Views: 3
Families of the Mafia
The six-part docuseries follows four neighboring mafia-related families for two years as they try to decide whether to cut their ties to organized crime or embrace its legacy.
Yakamoz S-245
After disaster strikes the Earth, a marine biologist on a research mission in a submarine must fight to advance the process into a conspiracy.
The Noughties
AngelaScanlonpresentsalight-heartedlookatthesocialandculturalchangesBritishsocietyexperiencedduringthefirstdecadeofthe21stcentury.
Fish or Die
Fourdiehardfishermenaredeterminedtobethefirsttofishthemostremotewatersleftonearth.Alongtheway,theywillbattletheelements,dodgedrugcartelsandendurehell,astheyrisktheirlivesinanattempttolivetheirdream.
SpongeBob SquarePants
Deep down in the Pacific Ocean in the subterranean city of Bikini Bottom lives a square yellow sponge named SpongeBob SquarePants. SpongeBob lives in a pineapple with his pet snail,…
Saved By The Barn
Dan McKernan relocated from Austin, Texas, to take over his family’s 140-year-old farm in Michigan and transform it into the “Barn Sanctuary,” a place for farm animals that have experienced…
Delilah
Delilah left a demanding white-shoe law firm a decade ago and hung up her own shingle so she could make raising her kids her number one priority. Now she takes…
World War II: The Last Heroes
AccountsofWorldWarIIevents,astoldbythosethatwereactuallythere.
Celebrity Watch Party
Celebrities and their families watch and react to the week’s most interesting television shows in the comfort of their own homes.
K.C. Undercover
K.C. Cooper, a high school math whiz and karate black-belt, learns that her parents are spies when they recruit her to join them in the secret government agency, The Organization….
The Story of Diana
Princess Diana’s life and legacy is explored through interviews with those who knew her best, as well as the world’s leading experts on her.
How It’s Made: Dream Cars
Join the legendary ‘How It’s Made’ crew as they immerse themselves in automobile heaven, and discover how incredible machines are designed and created. From a Maserati to the Audi R8,…
Cinema Toast
This anthology series is a post-modernist reinvention of older movies that turns pre-existing imagery from the public domain on its head to tell brand new unique stories spanning genres including…
Jack Whitehall: Travels With My Father
Comic Jack Whitehall invites his stodgy, unadventurous father to travel with him to odd locations and events in an attempt to strengthen their bond.
The Latino Experience
In a three-hour presentation of nonfiction and fiction short films, The Latino Experience explores a broad collection of experiences, perspectives, and points of view to highlight the diversity of the…
Naked and Afraid
What happens when you put two complete strangers – sans clothes – in some of the most extreme environments on Earth? Each male-female duo is left with no food, no…