Baywatch Season 2 Episode 9
Eddie’s life is torn apart by the accusation of statutory rape from the overprotective father of a lonely teenager trying to make friends lied to a group of other teenage girls about her encounter with Eddie (which one of the other girls told her father to get rid of her), while Mitch deals with the anger of a paraplegic former lifeguard.
Views: 4
Serie: Baywatch
Episode Title: The Trophy
Air Date: 1991-11-11
Married to Medicine Houston
Thehardworkingdoctorsanddoctorswivesstruggletostaymarriedtoaspousewhoismarriedtomedicine.Tryingtofindtimeforkidsandfriendshipsandromanceoreliteparty’scanbehard.Afterofyearsofstudyandclimbingtothetopisitnowtoolatetohaveafamily,orcanyouhaveitall.Ashandra,Elly,Erica,Monika,andRachelwilltryandhaveitall.
Shadowplay
Max McLaughlin is an American cop who arrives in Berlin in the summer of 1946 to help create a police force in the chaotic aftermath of the war.
Perry Mason
The cases of master criminal defense attorney Perry Mason and his staff who handled the most difficult of cases in the aid of the innocent.
ChalkZone
ChalkZone is an American animated television series created by Bill Burnett and Larry Huber and produced by Frederator Studios for the Nickelodeon TV channel. The series follows Rudy Tabootie, an…
Bleach
The show revolves around Ichigo Kurosaki, a good-hearted 15-year-old high school student who carries the undesired ability to see spirits. Others in his family (two sisters and his father) carry…
Surviving Jack
A boy becomes a man, and a man becomes a father, in a time before coming of age was something you could Google.
The Crow: Stairway to Heaven
The Crow: Stairway to Heaven was a 1998 Canadian television series created by Bryce Zabel spun off from the The Crow film series starring Mark Dacascos in the lead role…
Badehotellet
BadehotelletisthestoryabouttheguestsandstaffatabeachhotelbytheNorthSeasanddunes.Attheheartofthestoryisthelivesofthreeyoungpeople,thechambermaidFie,themerchant’sdaughterAmanda,andthelocalfishermanMorten.Theirfatesareintertwined,andtheirstoriesareaboutemancipatingthemselvesfromtheplansotherpeoplehavemadeontheirbehalf,theattemptsonsocialascent,andaboutlosingandfindingoneselfontheway.Theseriesisinspiredbythewayoflifeatthemanyseasidehotelsofthepast,andreflectsourowntimewithitsmixtureoffinancialcrisis,denial,anddreamsofhappiness.Thestorytakesplaceintheyears1928-33wheretheworldisfallingapart.Thecharacterswillgothroughtearsandlaughterinthecaptivatingjourneythattakesplaceastimeschangefromoptimismtocrisis.It’samulti-plot-seriesthatdynamicallyshiftsbetweenupstairsanddownstairs,andbetweenseriousnessandhumour.WrittenbyBadehotellet
Residue
Thegovernmentcover-upofthecausesbehindamassiveexplosioninafuturisticUKmetropolisspurphotojournalistJenniferPrestonontosearchforthetruthandintheprocessblowopenaparanormalphenomenonhauntingthecity.
Rostered On
RosteredOnisanindependentAustraliancomedyshowbasedaroundthedaytodaystrugglesofworkingforafacelessretailcorporationElectroworld.
Connecting…
An ensemble comedy about a group of friends trying to stay close (and sane) through video chats as they share the highs and lows of these extraordinary times.
Below Deck
The upstairs and downstairs worlds collide when this young and single crew of “yachties” live, love and work together onboard a luxurious mega yacht while tending to the ever-changing needs…
What We Do in the Shadows
A documentary-style look into the daily (or rather, nightly) lives of three vampires in Staten Island who have “lived” together for hundreds and hundreds of years.
Married By Mom and Dad
Online dating, mobile apps, and matchmaking through friends may be viable options for some, but not all. When the modern ways of dating don’t work, four singles go to the…
American Gothic
A prominent Boston family attempts to redefine itself in the wake of a chilling discovery that links their recently deceased patriarch to a string of murders spanning decades — amid…
Trapped
As a ferry carrying 300 passengers from Denmark pulls into an Icelandic town’s small port, heavy snow begins to fall. The ferry can’t leave until the storm passes and the…
Marvel’s Runaways
Every teenager thinks their parents are evil. What if you found out they actually were? Six diverse teenagers who can barely stand each other must unite against a common foe…
The First Lady
A revelatory reframing of American leadership through the lens of the First Ladies. Exploring everything from their journeys to Washington, family life, and world-changing political contributions, the impact of the…